PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC233888.1_FGP002
Common NameCOL7, LOC103641806, ZEAMMB73_093452, Zm.144681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 323aa    MW: 34011.9 Da    PI: 5.0355
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC233888.1_FGP002genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.26.9e-082056437
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....H 37
                       r C+ ++ + ++l+C+ +  +lC+ C    H g    H
  AC233888.1_FGP002 20 RPCDACGAEAARLYCRADAAFLCAGCDARAH-GagsrH 56
                       68**************************999.435667 PP

2zf-B_box23.11.5e-0759103341
           zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                         + C+ +e+ ++   C+ +   lC++C   +H+       H++ p
  AC233888.1_FGP002  59 VWLCEVCEHAPAAVTCRADAAALCASCDADIHSAnplasrHERLP 103
                        679*****************************6688888898876 PP

3CCT713e-24236279144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k++
  AC233888.1_FGP002 236 REARLMRYREKRKSRRFDKTIRYASRKAYAETRPRIKGRFAKRT 279
                        9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.5231761IPR000315B-box-type zinc finger
SMARTSM003364.7E-81761IPR000315B-box-type zinc finger
PfamPF006435.6E-62056IPR000315B-box-type zinc finger
CDDcd000216.74E-92061No hitNo description
PROSITE profilePS5011910.32457104IPR000315B-box-type zinc finger
PfamPF006437.2E-659104IPR000315B-box-type zinc finger
CDDcd000213.70E-860104No hitNo description
SMARTSM003366.3E-962104IPR000315B-box-type zinc finger
PfamPF062034.2E-18236278IPR010402CCT domain
PROSITE profilePS5101716.896236278IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MKGDEKSAGG APAYWGLGAR PCDACGAEAA RLYCRADAAF LCAGCDARAH GAGSRHARVW  60
LCEVCEHAPA AVTCRADAAA LCASCDADIH SANPLASRHE RLPVAPFFGE LADAPKPFAS  120
SAAVPKAADD DGSNEAEAAS WLLPEPDHGQ KEGATTEVFF ADSDPYLDLD FARSMDDIKT  180
IGVQGGPPEL DLAGAKLFYS DDSMNHSVSS SEAAVVPDAV AGAAPEVAVV CRGLEREARL  240
MRYREKRKSR RFDKTIRYAS RKAYAETRPR IKGRFAKRTP GAGADGEEPL EEHEEIYSSA  300
AAAVAALMAP GGADADYGVV PTH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.246580.0leaf| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC233888.1_FG002
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC233888.1_FGP002
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279840.0KJ727984.1 Zea mays clone pUT6100 C2C2-CO-like transcription factor (COL7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663359.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLK7UJZ20.0K7UJZ2_MAIZE; C2C2-CO-like transcription factor
STRINGAC233888.1_FGP0020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.14e-45CONSTANS-like 3